SPRR3, Recombinant, Human, aa2-169, His-SUMO-Tag (Small Proline-rich Protein 3)

Catalog Number: USB-375397
Article Name: SPRR3, Recombinant, Human, aa2-169, His-SUMO-Tag (Small Proline-rich Protein 3)
Biozol Catalog Number: USB-375397
Supplier Catalog Number: 375397
Alternative Catalog Number: USB-375397-20,USB-375397-100
Manufacturer: US Biological
Category: Molekularbiologie
Cross-linked envelope protein of keratinocytes. Source: Recombinant protein corresponding to aa2-169 from human SPRR3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34kD Amino Acid Sequence: SSYQQKQTFTPPPQLQQQQVKQPSQPPPQEI
Molecular Weight: 34
UniProt: Q9UBC9
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris, 50% glycerol.