SSNA1, Recombinant, Human, aa1-119, GST-Tag (Sjoegren Syndrome Nuclear Autoantigen 1)

Product Overview

• Article Name: SSNA1, Recombinant, Human, aa1-119, GST-Tag (Sjoegren Syndrome Nuclear Autoantigen 1)
• Biozol Catalog Number: USB-375420
• Supplier Catalog Number: 375420
• Alternative Catalog Number: USB-375420-20,USB-375420-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-119 from human SSNA1, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~40.5kD Amino Acid Sequence: TQQGAALQNYNNELVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNENLARKIASRNEFDRTIAETEAAYLK

Product Properties

• Molecular Weight: 40.5
• UniProt: O43805
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.