SSX2, Recombinant, Human, aa1-188, His-SUMO-Tag (Protein SSX2)

Product Overview

• Article Name: SSX2, Recombinant, Human, aa1-188, His-SUMO-Tag (Protein SSX2)
• Biozol Catalog Number: USB-375423
• Supplier Catalog Number: 375423
• Alternative Catalog Number: USB-375423-20,USB-375423-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Could act as a modulator of transcription. Source: Recombinant protein corresponding to aa1-188 from human SSX2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.6kD Amino Acid Sequence: MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKE

Product Properties

• Molecular Weight: 37.6
• UniProt: Q16385
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.