SSX4, Recombinant, Human, aa1-188, GST-Tag (Protein SSX4)

Product Overview

• Article Name: SSX4, Recombinant, Human, aa1-188, GST-Tag (Protein SSX4)
• Biozol Catalog Number: USB-375424
• Supplier Catalog Number: 375424
• Alternative Catalog Number: USB-375424-20,USB-375424-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Could act as a modulator of transcription. Source: Recombinant protein corresponding to aa1-188 from human SSX4, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~48.9kD Amino Acid Sequence: MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKM

Product Properties

• Molecular Weight: 48.9
• UniProt: O60224
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.