SSX5, Recombinant, Human, aa1-229, GST-Tag (Protein SSX5)

Product Overview

• Article Name: SSX5, Recombinant, Human, aa1-229, GST-Tag (Protein SSX5)
• Biozol Catalog Number: USB-375425
• Supplier Catalog Number: 375425
• Alternative Catalog Number: USB-375425-20,USB-375425-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Could act as a modulator of transcription. Source: Recombinant protein corresponding to aa1-229 from human SSX5, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.3kD Amino Acid Sequence: MNGDDAFVRRPRVGSQIPQKMQKHPWRQVCDRGIHLVNLS

Product Properties

• Molecular Weight: 53.3
• UniProt: O60225
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.