TGIF2LX, Recombinant, Human, aa1-241, His-SUMO-Tag (Homeobox Protein TGIF2LX)

Product Overview

• Article Name: TGIF2LX, Recombinant, Human, aa1-241, His-SUMO-Tag (Homeobox Protein TGIF2LX)
• Biozol Catalog Number: USB-375545
• Supplier Catalog Number: 375545
• Alternative Catalog Number: USB-375545-20,USB-375545-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May have a transcription role in testis. Source: Recombinant protein corresponding to aa1-241 from human TGIF2LX, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.7kD Amino Acid Sequence: MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMS

Product Properties

• Molecular Weight: 42.7
• UniProt: Q8IUE1
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.