TM4SF1, Recombinant, Human, aa115-161, His-Tag (Transmembrane 4 L6 Family Member 1)

Product Overview

• Article Name: TM4SF1, Recombinant, Human, aa115-161, His-Tag (Transmembrane 4 L6 Family Member 1)
• Biozol Catalog Number: USB-375595
• Supplier Catalog Number: 375595
• Alternative Catalog Number: USB-375595-20,USB-375595-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa115-161 from human TM4SF1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~7.3kD Amino Acid Sequence: LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS Storage and Stability: May be stor

Product Properties

• Molecular Weight: 7.3
• UniProt: P30408
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.