TMEM14B, Recombinant, Human, aa1-114, GST-Tag (Transmembrane Protein 14B)

Product Overview

• Article Name: TMEM14B, Recombinant, Human, aa1-114, GST-Tag (Transmembrane Protein 14B)
• Biozol Catalog Number: USB-375598
• Supplier Catalog Number: 375598
• Alternative Catalog Number: USB-375598-20,USB-375598-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-114 from human TMEM14B, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.1kD Amino Acid Sequence: MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAGLGAYQLYQDPRNVWGFLAATSVTFVGVMGM

Product Properties

• Molecular Weight: 39.1
• UniProt: Q9NUH8
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.