TMEM25, Recombinant, Human, aa27-322, His-SUMO-Tag (Transmembrane Protein 25)

Product Overview

• Article Name: TMEM25, Recombinant, Human, aa27-322, His-SUMO-Tag (Transmembrane Protein 25)
• Biozol Catalog Number: USB-375599
• Supplier Catalog Number: 375599
• Alternative Catalog Number: USB-375599-20,USB-375599-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa27-322 from human TMEM25, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~48.2kD Amino Acid Sequence: ELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRA

Product Properties

• Molecular Weight: 48.2
• UniProt: Q86YD3
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.