UL128, Recombinant, Human Cytomegalovirus, aa1-171, His-Tag (Uncharacterized Protein UL128)

Product Overview

• Article Name: UL128, Recombinant, Human Cytomegalovirus, aa1-171, His-Tag (Uncharacterized Protein UL128)
• Biozol Catalog Number: USB-375769
• Supplier Catalog Number: 375769
• Alternative Catalog Number: USB-375769-20,USB-375769-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant full length protein corresponding to aa1-171 from human cytomegalovirus (strain AD169) (HHV-5) UL128, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~21.7kD Amino Acid Sequence: MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEF

Product Properties

• Molecular Weight: 21.7
• UniProt: P16837
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.