UL130, Recombinant, Human cytomegalovirus, aa26-214, His-SUMO-Tag (Uncharacterized Protein UL130)

Product Overview

• Article Name: UL130, Recombinant, Human cytomegalovirus, aa26-214, His-SUMO-Tag (Uncharacterized Protein UL130)
• Biozol Catalog Number: USB-375770
• Supplier Catalog Number: 375770
• Alternative Catalog Number: USB-375770-20,USB-375770-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa 26-214 from human cytomegalovirus UL130, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.7kD Amino Acid Sequence: MLRLLLRHHFHCLLLCAVWATPCLASPWSTLTANQNPSPPWSKLTYSKPHDAATFYCPF

Product Properties

• Molecular Weight: 40.7
• UniProt: P16772
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.