UL131, Recombinant, Human, aa1-76, His-Tag (Cytomegalovirus Uncharacterized protein UL131)

Product Overview

• Article Name: UL131, Recombinant, Human, aa1-76, His-Tag (Cytomegalovirus Uncharacterized protein UL131)
• Biozol Catalog Number: USB-375771
• Supplier Catalog Number: 375771
• Alternative Catalog Number: USB-375771-20,USB-375771-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-76 from human UL131, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~11.7kD Amino Acid Sequence: MCMMSHNKAFFLSLQHAAVSGVAVCLSVRRGAGSVPAGNRGKKTIITEYRITGTRALARCPTKPVTSMWNSSWTSR Storage

Product Properties

• Molecular Weight: 11.7
• UniProt: P16773
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.