Uncharacterized Protein C4orf3, Recombinant, Human, aa1-44, His-SUMO-Tag (C4orf3)

Product Overview

• Article Name: Uncharacterized Protein C4orf3, Recombinant, Human, aa1-44, His-SUMO-Tag (C4orf3)
• Biozol Catalog Number: USB-375777
• Supplier Catalog Number: 375777
• Alternative Catalog Number: USB-375777-20,USB-375777-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-44 from human C4orf3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.8kD Amino Acid Sequence: MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSY Storage and Stability: May be st

Product Properties

• Molecular Weight: 20.8
• UniProt: Q8WVX3
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.