Uncharacterized Protein C9orf163, Recombinant, Human, aa1-203, His-SUMO-Tag (C9orf163)

Product Overview

• Article Name: Uncharacterized Protein C9orf163, Recombinant, Human, aa1-203, His-SUMO-Tag (C9orf163)
• Biozol Catalog Number: USB-375778
• Supplier Catalog Number: 375778
• Alternative Catalog Number: USB-375778-20,USB-375778-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-203 from human C9orf163, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.2kD Amino Acid Sequence: MPGPLTCTPAWQGQGRAAAFLCCSFQRAGAVVGVPARWHRGRLSSQQRLRSSLGGSHPCPQLGRRLVREGVISV

Product Properties

• Molecular Weight: 38.2
• UniProt: Q8N9P6
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.