UPF0454 Protein C12orf49, Recombinant, Human, aa34-205, His-SUMO-Tag (C12orf49)

Product Overview

• Article Name: UPF0454 Protein C12orf49, Recombinant, Human, aa34-205, His-SUMO-Tag (C12orf49)
• Biozol Catalog Number: USB-375786
• Supplier Catalog Number: 375786
• Alternative Catalog Number: USB-375786-20,USB-375786-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa34-205 from human C12orf49, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.7kD Amino Acid Sequence: TFKQEERAVRDRNLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNV

Product Properties

• Molecular Weight: 35.7
• UniProt: Q9H741
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.