VEGFA, Recombinant, Rabbit, aa51-511, His-SUMO-Tag (Vascular Endothelial Growth Factor A)

Product Overview

• Article Name: VEGFA, Recombinant, Rabbit, aa51-511, His-SUMO-Tag (Vascular Endothelial Growth Factor A)
• Biozol Catalog Number: USB-375812
• Supplier Catalog Number: 375812
• Alternative Catalog Number: USB-375812-20,USB-375812-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa51-511 from rabbit VEGFA, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~65.7kD Amino Acid Sequence: YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPT

Product Properties

• Molecular Weight: 65.7
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.