VSTM2L, Recombinant, Human, aa25-204, His-SUMO-Tag (V-set and Transmembrane Domain-containing Protein 2-like Protein)

Product Overview

• Article Name: VSTM2L, Recombinant, Human, aa25-204, His-SUMO-Tag (V-set and Transmembrane Domain-containing Protein 2-like Protein)
• Biozol Catalog Number: USB-375848
• Supplier Catalog Number: 375848
• Alternative Catalog Number: USB-375848-20,USB-375848-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa25-204 from human VSTM2L, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.0kD Amino Acid Sequence: TRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLK

Product Properties

• Molecular Weight: 36
• UniProt: Q96N03
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.