VWA5B2, Recombinant, Human, aa781-862, His-SUMO-Tag (Von Willebrand Factor A Domain-containing Protein 5B2)

Product Overview

• Article Name: VWA5B2, Recombinant, Human, aa781-862, His-SUMO-Tag (Von Willebrand Factor A Domain-containing Protein 5B2)
• Biozol Catalog Number: USB-375854
• Supplier Catalog Number: 375854
• Alternative Catalog Number: USB-375854-20,USB-375854-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa781-862 from human VWA5B2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.6kD Amino Acid Sequence: PRKPSLGAILDGPSPEPGQQLGQGLDDSGNLLSPAPMDWDMLMEPPFLFTAVPPSGELAPPAVPPQAPRCHVVI

Product Properties

• Molecular Weight: 24.6
• UniProt: Q8N398
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.