WDR38, Recombinant, Human, aa1-314, GST-Tag (WD Repeat-containing Protein 38)

Product Overview

• Article Name: WDR38, Recombinant, Human, aa1-314, GST-Tag (WD Repeat-containing Protein 38)
• Biozol Catalog Number: USB-375857
• Supplier Catalog Number: 375857
• Alternative Catalog Number: USB-375857-20,USB-375857-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-314 from human WDR38, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~61.3kD AA Sequence: MNSGVPATLAVRRVKFFGQHGGEVNSSAFSPDGQMLLTGSEDGCVYGWETRSGQLLWRLGGHTGPVKFCRFSPDGHLFASASCDCTVRLW

Product Properties

• Molecular Weight: 61.3
• UniProt: Q5JTN6
• Purity: ~90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.