Filter options
Categories
Manufacturer
- 2mag (80)
- 3D Bio-Tissues (10)
- 3Helix (12)
- 4basebio (27)
- A. Johnen Verpackungen (15)
- A. Rahf Laborbedarf (4)
- ABP Biosciences (650)
- ABclonal (25996)
- ADS Biotec Ltd (49)
- AHN Biotechnologie (18)
- AIT France (410)
- ALPCO (391)
- ARP American Research Products (7517)
- ATAGO (117)
- ATTO-TEC (836)
- Abbexa (329790)
- Abbkine Scientific (3427)
- Abcepta (109876)
- Abeomics (36039)
- Abiel (12)
- Abmole Bioscience (10024)
- Abnova (95379)
- Absolute Antibody (32814)
- AcroBiosystems (9470)
- Active Motif (3503)
- AddexBio (464)
- Adooq Bioscience (38065)
- Advantec (1561)
- Affinity Biosciences (32766)
- Agdia EMEA (2268)
- Agrisera (2528)
- Ahlstrom Falun (64)
- Ahlstrom-Munksjö (28)
- Aimplex Biosciences (743)
- Alan and Co (3)
- Albert Kuhn (8)
- Almedica (6)
- Alpha Diagnostic (14236)
- Alpha Laboratories (8)
- AlphaScience (3)
- AlphaTecSystems (197)
- AlphaThera (112)
- Altmann Analytik (3)
- Amarell (157)
- Amcor (4)
- Ampersand Biosciences (71)
- Amplitech (1)
- AnaSpec (2228)
- Ananda Devices (2)
- Anatrace (1827)
- Anogen-Yes Biotech Laboratories (683)
- Antibodies Incorporated (2287)
- Antibodies.com (172846)
- Anton Paar (23)
- ApexBio (26731)
- Apollo Herkenrath (27)
- Aptum Biologics (135)
- Aquarray (140)
- Arbor Assays (221)
- Arctiko (38)
- Argos (1)
- Arlington Scientific (86)
- As One (888)
- Astra Biotech GmbH (56)
- Atlas Antibodies (44665)
- Aves Labs (95)
- Aviva (808102)
- Azenta (10)
- B-Safety (42)
- B. Braun (236)
- BANDELIN (310)
- BEN Biochemical (216)
- BINDER GmbH (295)
- BIO SB (4167)
- BIOMAT (419)
- BIOZOL (88)
- BMA Biomedicals (1001)
- BOCHEM (2)
- BOCHEM Instrumente GmbH (806)
- BR Solution (36)
- BRAND (2458)
- BRinova (2)
- BT Lab (22484)
- Bachem (6605)
- Barnstead (11)
- BartelsRieger (55)
- Behr (329)
- Beijing Grinder (154)
- Bel-Art (227)
- BellBrook Labs (133)
- Benchmark Scientific (4)
- Bergmann Kartonagen (9)
- Bierbaum-Proenen (75)
- Bio X Cell (5186)
- BioActs (557)
- BioAssay Systems (448)
- BioAssay Works (104)
- BioChain Institute (2438)
- BioChem Fluidics (451)
- BioPorto Diagnostics (256)
- BioServUK (424)
- BioTeZ (206)
- BioVendor (1305)
- Biochrom (76)
- Bioconcept (432)
- Biogal (123)
- Biolegend (32580)
- Biomatik Corporation (60484)
- Biomedica (31)
- Bionis (31)
- Biorbyt (1315548)
- Bioss (273344)
- Biosynex (119)
- Biosynth (277910)
- Biotium (42157)
- BlueGene (105108)
- Boettger (36)
- Bohemia Cristal (134)
- Bohlender (984)
- Boster Bio (57257)
- Brady (229)
- BrainXell (22)
- Buddeberg (58)
- BÜCHI (43)
- Bürkle (1218)
- C. Giese GmbH (52)
- CALPRO (6)
- CETI (655)
- CH3 BioSystems (45)
- Cape Biologix Technologies (61)
- Caprico Biotechnologies (3585)
- Cedarlane (25005)
- Cell Biolabs (659)
- Cellcolabs (2)
- Celprogen (11208)
- CeramTec (4)
- CertoClav (33)
- Charles River Laboratories (357)
- Chem Service (9031)
- ChemScene (103583)
- Chondrex (895)
- Chromatrap (141)
- Citotest (6)
- Clare Chemical Research (28)
- Clonit (268)
- Cloud-Clone (39960)
- Cole-Parmer (305)
- Columbia Biosciences (294)
- Concise Separations (171)
- Coolike (5)
- Cope (1)
- Corning (267)
- Cortez Diagnostics (7)
- Covalab (10799)
- Creative BioMart (55210)
- Creative Biolabs (38757)
- Cryonos (87)
- Crystal (39)
- Cusabio (110858)
- Cyagen Biosciences Inc. (755)
- Cygnus Technologies (500)
- Cytognos (66)
- Cytoskeleton (405)
- DACOS (10)
- DB-Biotech (968)
- DIA.PRO (128)
- DIAsource ImmunoAssays (494)
- DLAB (3)
- DLDEVELOP (26331)
- DOSTMANN electronic (107)
- DRG Instruments (748)
- DWK Life Sciences (1861)
- DYMO (111)
- Daresbury Proteins (55)
- Deutsch und Neumann (447)
- Dextra Laboratories (780)
- Diba (1328)
- Dietmar Knabe (2)
- Dominique Dutscher (4)
- Dr. Weigert (54)
- Dräger (147)
- DuPont (28)
- ELITech (31)
- ELK Biotechnology (21290)
- ESCO Lifesciences GmbH (211)
- EXBIO (4561)
- EXCELITAS (16)
- EastCoast Bio (2068)
- Ebba Biotech (99)
- Echelon Biosciences (2318)
- Ecoli Dx, s.r.o. (251)
- EdgeBio (180)
- Elabscience (30505)
- Elkay (25)
- Elma Schmidbauer GmbH (129)
- Encapsula NanoSciences (16)
- Endotherm (989)
- Enzo Life Sciences (7818)
- Eppendorf (4)
- Epredia (233)
- EuroClone (399)
- Eurocell (13)
- Eurospital (14)
- Everest (6950)
- FRYKA (24)
- FabGennix (6539)
- Fahsig (3)
- Firebird Optics (46)
- Firefly (891)
- Focus Biomolecules (1521)
- Franz Mensch (19)
- Fritsch (287)
- Fritz Arndt (10)
- Fuller (172)
- Fuller Laboratories (12)
- Funke Gerber (110)
- Future Fields (9)
- GA INTERNATIONAL (25)
- GVS (49)
- Gamma Proteins UK (20)
- Ganterie (4)
- Gebra (40)
- GeneDireX (231)
- GeneTex (49946)
- Generic Assays / Medipan (3)
- Genesee Scientific (5458)
- Genscript (2867)
- Gentian (8)
- Gerber Instruments (120)
- Gerd Schneider (12)
- Gerhard Analytical Systems (2)
- Glindemann (8)
- Golden Gate Scientific (4)
- Gorr Transporttechnik (26)
- Grant (324)
- Grauer (14)
- Green Mountain Antibodies (110)
- Greiner Bio-One (74)
- Grosseron (3)
- Grün-Pumpen (10)
- Guangzhou JET Bio-Filtration (127)
- HCL (23)
- HK-Pack (23)
- HORO Dr. Hofmann (4)
- HUABIO (5639)
- HUMAN (224)
- HWS Labortechnik (66)
- Hahnemühle (327)
- Hailo (2)
- Hanhart Chronographen 1882 (15)
- HansaBioMed (160)
- Hardy Diagnostics (3082)
- Harry Gestigkeit (71)
- Hartmann (39)
- Heathrow Scientific (463)
- Hecht Glaswarenfabrik (230)
- Heidolph (418)
- Heinz Herenz Hamburg (54)
- Hellma (185)
- HelloBio (1429)
- Heraeus Noblelight (394)
- Hettich Benelux (93)
- Hielscher Ultrasonics (30)
- High Purity Standards (2548)
- Hilgenberg (50)
- Hirschmann Laborgeräte (844)
- Honeywell Safety Products (54)
- Hospidex (20)
- Huber (245)
- Huixia (13)
- Hycult (1679)
- Hülden (17)
- Hünersdorff (99)
- IBA (319)
- IBI Scientific (1327)
- ICL (937)
- IDCP B.V. (46)
- IHC WORLD (559)
- IKA (1135)
- ION Biosciences (120)
- IQ Products (750)
- ISOHEAT GmbH (155)
- ISOLAB (619)
- Ideal-tek (66)
- Igefa (22)
- ImmuQuest (471)
- ImmunoChemistry Technologies (338)
- ImmunoReagents (1136)
- Immunostep (435)
- Industrial Physics (44)
- Ingenetix (608)
- Interstuhl (58)
- Invent BioTechnologies (77)
- Isca Biochemicals (410)
- JUTEC (23)
- Jackson ImmunoResearch (3957)
- Johann W. Schimmel (11)
- Juchheim Laborgeräte (47)
- Julabo (355)
- KD Scientific (18)
- KGW-Isotherm (195)
- KINEMATICA GmbH (103)
- Kaiser (2)
- Kamiya Biomedical Company (2332)
- Karl Hammacher (124)
- Kartell LABWARE (598)
- Kautex (289)
- Kementec (77)
- Kerafast (2958)
- Kern und Sohn (1053)
- Keter Luxembourg (1)
- Key Surgical (5)
- Kimberly-Clark (154)
- Kleinfeld Labortechnik (14)
- Klett Kunststofftechnik (12)
- Konus Italia Group (22)
- Korff (36)
- Krishgen Biosystems (22438)
- Kroschke (26)
- Krüss (49)
- Kundert Vario (10)
- Köttermann (56)
- LAUDA (127)
- LEHRICH (10)
- LEONHARDY VP (29)
- LGC Standards (17563)
- LKT Labs (3126)
- LLG Labware (13842)
- LMS Consult (1)
- LOSCH (1)
- La-Pha-Pack (80)
- Lab-Club (2439)
- Laborgeräte Süd (18)
- Lampire Biological Labs (4226)
- Lamy Rheology (46)
- Langkavel Office + Lab (24)
- Larodan (5107)
- Leadgene Biomedical (2061)
- Leinco Technologies (1513)
- Lenz Laborglas (1310)
- Lepu Medical (1)
- Licefa (1)
- Liebherr (93)
- LifeSpan Biosciences (1234547)
- LifeTein (24)
- Liga Trap Technologies (105)
- Linaris (5835)
- Linker Industrie-Technik (277)
- Liposoma research (88)
- List Biological Labs (83)
- Ludwig Schneider (376)
- Lutz Pumpen (35)
- Lybe Scientific (9)
- MABTECH (1818)
- MAPA (138)
- MBL (14932)
- MEDITE (1)
- MERCK Millipore (92)
- MP Biomedicals Germany (10803)
- MS Validated Antibodies (453)
- Maassen GmbH (17)
- Macherey-Nagel (2082)
- Manulatex (13)
- Marienfeld (158)
- Matriks Biotechnology (101)
- MaxVision Biosciences (112)
- MedNet (12)
- MedSchenker (14)
- MedchemExpress (132479)
- Medix Biochemica (2086)
- Memmert (286)
- Merck (68)
- MetallWarenfabrik Mühlacker (10)
- Mettler-Toledo (557)
- Micros Produktion (17)
- Miele (87)
- Millipore (223)
- Mirus Bio (194)
- MoBiTec (322)
- Molecular Dimension (2100)
- Monosan (2572)
- Montana Molecular (216)
- Morgan Advanced Materials (217)
- MyBiosource (2743753)
- NABAS (24)
- NORMA (75)
- NSJ Bioreagents (33967)
- Nabertherm (219)
- NanoHelix (186)
- NanoTag Biotechnologies (501)
- Nanoprobes (235)
- Nasco Sampling (47)
- NeXtal (381)
- NeoBiotechnologies (15825)
- Neuromics (2128)
- Nitritex (91)
- Nordic BioSite (303750)
- Nordic Lab (60)
- NordicMubio (2923)
- Normag (4)
- Normax (4)
- Normensand (1)
- Novelis Deutschland GmbH (16)
- OHAUS (651)
- OLM Diagnostics (8)
- OMNILAB (31)
- ORI (3)
- OSRAM (148)
- OZ Biosciences (503)
- OaCP (114)
- Obermeier (7)
- OncoDianova (14)
- Operon (78)
- Oxford Biomedical Research (955)
- P/S Kunststoffwerke (18)
- PBL Assay Science (137)
- PGP (32)
- PMS TIP TEKNOLOJILERI (45)
- PanPath (682)
- Peak Scientific (7)
- PeproTech (6717)
- Pfennig Reinigungstechnik GmbH (37)
- Phoenix Instrument (37)
- Poly-Dtech (55)
- PolyScience (87)
- PrimerDesign (1645)
- ProFoldin (485)
- ProSci (47141)
- ProSpec-Tany Technogene (6950)
- ProteinArk (1130)
- ProteoGenix (6062)
- QED Bioscience (2573)
- Qkine (365)
- Quantimetrix (41)
- RD-Biotech (41)
- RJH Biosciences (29)
- ROBU (90)
- ROMMELSBACHER (3)
- RSG Rostfrei (84)
- Randox (2)
- Ratiolab (274)
- Rauschenberger Innovations (4)
- Reagecon (8171)
- Reagena (34)
- Reitenspieß-Bürsten (97)
- Reprocell (237)
- Resch Laborglas (31)
- Retsch (896)
- Rettberg (37)
- RevMAb (439)
- Riken Keiki (30)
- Rische + Herfurth (46)
- Ritter (99)
- Rixius (54)
- Roboscreen (153)
- Rockland Immunochemicals (13779)
- Roland Watzdorf (18)
- Rometsch GmbH (15)
- Rötzmeier Sicherheitsbehälter (75)
- S-Bio (208)
- SCAT Europe GmbH (387)
- SHP (50)
- SOCOREX (366)
- Saint-Gobain (578)
- Salimetrics (51)
- Saropack (1)
- Sarstedt (6)
- Sartorius (1725)
- Sceti (3656)
- Scherf Präzision (164)
- Schorpp (9)
- Schott (66)
- Schwan (28)
- Schwegmann Filtrations (25)
- Schweizer (5)
- Schülke und Mayr (13)
- Scientific Industries (151)
- ScyTek Laboratories (2772)
- SeLENOZYME (87)
- Selleck (10577)
- Semperit (51)
- Shenandoah (1764)
- SiLI (17)
- Sievert (2)
- SignalChem (2193)
- SignalChem Diagnostics (730)
- Sileks (16)
- Silnova (20)
- Sino Biological (262784)
- Snoltherm (63)
- Somagenics (164)
- Sonation (4)
- Sonepar Deutschland (4)
- Sontara (9)
- SouthernBiotech (3625)
- Spherotech (1018)
- Starke Laborbedarf (32)
- Starna (25)
- Statens Serum Institut (321)
- StemBioSys (92)
- Sterilin (38)
- Surplus Systems (16)
- Svanova (39)
- Svar Life Science (104)
- Synabs (1219)
- System Biosciences (2398)
- SÖHNGEN (53)
- TENAK (662)
- TFA Dostmann (67)
- TNC Bio (6)
- TOKU-E (2851)
- TargetMol (90851)
- The Native Antigen Company (2141)
- Thermax (14)
- Thermo (7)
- Thermo Elect.LED GmbH (1035)
- Thies Clima (2)
- Thomas Pumpen (45)
- Tintometer (457)
- Toronto Bioscience (361)
- Toronto Research Chemicals (88766)
- Trevigen (336)
- Trinity Biotech (48)
- U-CyTech biosciences (476)
- UBPBio, LLC (914)
- US Biological (660608)
- USBECK (232)
- Ubiquigent (592)
- Umweltanalytik Holbach (12)
- Unigloves (191)
- Ushio (36)
- VIDIA (156)
- VITRO (1324)
- VMRD (346)
- VOLTRONIC (35)
- VWR (26)
- Vacuubrand (417)
- Vazyme Biotech (917)
- Vector Laboratories (421)
- VectorBuilder (229)
- Velp Scientifica (146)
- Vikan (90)
- ViroStat (987)
- Virusys (348)
- VmP (8)
- WEDO (32)
- Waldmann (2)
- Waring (17)
- Water-i.d. (105)
- Werner Arzneimittel (1)
- Wilhelm Schröder (9)
- Wolf Maschinenbau AG (4)
- Württ. Drahtwarenfabrik (59)
- Württembergische Allplastik (14)
- Xylem Analytics (622)
- Yashraj Biotechnology (55)
- YouSeq (69)
- ZIRBUS technology (62)
- ZVG Zellstoffvertrieb (38)
- ZellBio (748)
- Zymo Research Europe (1222)
- Zytomed Systems (8556)
- asecos (99)
- baseclick (194)
- biomedis (2)
- dianova (1828)
- edding (140)
- eutecma (18)
- helo (4)
- highQu (106)
- interscience (87)
- magtivio (210)
- messner emtronic (21)
- nanoComposix (787)
- nanoimmunotech (214)
- peptides and elephants (1742)
- proQuarz (48)
- reddot Biotech (13379)
- schuett-biotec (234)
- stakpure (79)
- tec-lab (17)
- tesa (2)
- trenzyme (15)
- uvex (356)
- vosla (77)
ß-Defensin-3, human (GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: Cys11-Cys40, Cys18-Cys33, Cys23-Cys41) (MW: 5155.22) Preis auf Anfrage
- Images: 0
- Applications: 0
Biozol Catalog Number: | APD-SP-100511-1 |
Manufacturer: | Alpha Diagnostic |
Application: | - |
Category: | Sonstiges |
Size: | 1 mg |
Show Prices |
![BIOZOL](https://www.biozol.de/vendor/avored-default/images/no-image-small.jpg)
(0) Images
Defensin-1 (human) HNP-1 (AA: Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridges Cys2-Cys30, Cys4-Cys19, and Cys 9-29 )) (MW: 3442.1) Preis auf Anfrage
- Images: 0
- Applications: 0
Biozol Catalog Number: | APD-SP-100512-1 |
Manufacturer: | Alpha Diagnostic |
Application: | - |
Category: | Sonstiges |
Size: | 1 mg |
Show Prices |
![BIOZOL](https://www.biozol.de/vendor/avored-default/images/no-image-small.jpg)
(0) Images
[D-Arg6] - Dynorphin A (1 - 13), porcine [Tyr-Gly-Gly-Phe-Leu-D-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys, MW: 1603.98] Preis auf Anfrage
- Images: 0
- Applications: 0
Biozol Catalog Number: | APD-SP-100514-5 |
Manufacturer: | Alpha Diagnostic |
Application: | - |
Category: | Sonstiges |
Size: | 5 mg |
Show Prices |
![BIOZOL](https://www.biozol.de/vendor/avored-default/images/no-image-small.jpg)
(0) Images
[D-Arg8] - Dynorphin A (1 - 13), porcine [Tyr-Gly-Gly-Phe-Leu-Arg-Arg-D-Arg-Arg-Pro-Lys-Leu-Lys, MW: 16471] Preis auf Anfrage
- Images: 0
- Applications: 0
Biozol Catalog Number: | APD-SP-100515-5 |
Manufacturer: | Alpha Diagnostic |
Application: | - |
Category: | Sonstiges |
Size: | 5 mg |
Show Prices |
![BIOZOL](https://www.biozol.de/vendor/avored-default/images/no-image-small.jpg)
(0) Images
Biotin-Dynorphin A (1-17) (AA: Biotin-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln) (MW: 2373.83) Preis auf Anfrage
- Images: 0
- Applications: 0
Biozol Catalog Number: | APD-SP-100516-1 |
Manufacturer: | Alpha Diagnostic |
Application: | - |
Category: | Sonstiges |
Size: | 1 mg |
Show Prices |
![BIOZOL](https://www.biozol.de/vendor/avored-default/images/no-image-small.jpg)
(0) Images
Dynorphin A (2 - 13), porcine (AA: Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys) (MW: 1440.81) Preis auf Anfrage
- Images: 0
- Applications: 0
Biozol Catalog Number: | APD-SP-100518-5 |
Manufacturer: | Alpha Diagnostic |
Application: | - |
Category: | Sonstiges |
Size: | 5 mg |
Show Prices |
![BIOZOL](https://www.biozol.de/vendor/avored-default/images/no-image-small.jpg)
(0) Images
Aldosterone Secretion Inhibiting Factor (1-35) (bovine) (AA: Ala-Leu-Arg-Gly-Pro-Lys-Met-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr (Disulfide bridge:Cys13-Cys29 Preis auf Anfrage
- Images: 0
- Applications: 0
Biozol Catalog Number: | APD-SP-100519-1 |
Manufacturer: | Alpha Diagnostic |
Application: | - |
Category: | Sonstiges |
Size: | 1 mg |
Show Prices |
![BIOZOL](https://www.biozol.de/vendor/avored-default/images/no-image-small.jpg)
(0) Images
Atrial Natriuretic Factor (1-24) (frog) (AA: Ser-Ser-Asp-Cys-Phe-Gly-Ser-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Met-Gly-Cys-Gly-Arg-Arg-Phe (MW: 2561.87) (Disulfide bridge:Cys4-Cys20) (MW: 2561.87) Preis auf Anfrage
- Images: 0
- Applications: 0
Biozol Catalog Number: | APD-SP-100520-05 |
Manufacturer: | Alpha Diagnostic |
Application: | - |
Category: | Sonstiges |
Size: | 0.5 mg |
Show Prices |
![BIOZOL](https://www.biozol.de/vendor/avored-default/images/no-image-small.jpg)
(0) Images
Biotin-ß-Endomorphin, human (AA: Biotin-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu) (MW: 3691.36) Preis auf Anfrage
- Images: 0
- Applications: 0
Biozol Catalog Number: | APD-SP-100521-1 |
Manufacturer: | Alpha Diagnostic |
Application: | - |
Category: | Sonstiges |
Size: | 1 mg |
Show Prices |
![BIOZOL](https://www.biozol.de/vendor/avored-default/images/no-image-small.jpg)
(0) Images
Atrial Natriuretic Factor (1-29) (chicken) (AA: Met-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Ile-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Met-Gly-Cys-Asn-Gly-Ser-Arg-Lys-Asn (Disulfide bridge Cys7-Cys23 )) (MW: 3160.7) Preis auf Anfrage
- Images: 0
- Applications: 0
Biozol Catalog Number: | APD-SP-100522-05 |
Manufacturer: | Alpha Diagnostic |
Application: | - |
Category: | Sonstiges |
Size: | 0.5 mg |
Show Prices |
![BIOZOL](https://www.biozol.de/vendor/avored-default/images/no-image-small.jpg)
(0) Images