Anti-CA12 Antibody 100ul, IgG2a, Clone: [CL0278], Unconjugated, Mouse, Monoclonal
Artikelnummer:
ATA-AMAB90637
Artikelname: |
Anti-CA12 Antibody 100ul, IgG2a, Clone: [CL0278], Unconjugated, Mouse, Monoclonal |
Artikelnummer: |
ATA-AMAB90637 |
Hersteller Artikelnummer: |
AMAb90637 |
Alternativnummer: |
ATA-AMAB90637-100,ATA-AMAB90637-25 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Mouse |
Kategorie: |
Antikörper |
Applikation: |
IHC, WB |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
HsT18816 |
Klonalität: |
Monoclonal |
Konzentration: |
1 |
Klon-Bezeichnung: |
[CL0278] |
Isotyp: |
IgG2a |
NCBI: |
771 |
UniProt: |
O43570 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Protein A purified |
Sequenz: |
TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
CA12 |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
IHC: 1:2500 - 1:5000, WB: 1 µg/ml |
|
Immunohistochemical staining of human kidney shows strong membranous immunoreactivity in renal tubules, but not glomeruli. |
|
Immunohistochemical staining of human rectum shows strong membranous positivity in glandular epithelial cells. |
|
Immunohistochemical staining of human stomach shows moderate membranous immunoreactivity in glandular cells. |
|
Immunohistochemical staining of human renal cancer shows membranous positivity in tumor cells. |
|
Lane 1: Marker [kDa] Lane 2: Human tonsil tissue lysate |
|
AMAb90637 |
|
|
|
AMAb90637 |
|
AMAb90637 |