SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), liquid formulation, Human
Artikelnummer:
TRZ-P2020-001_1000
- Bilder (8)
| Artikelname: | SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), liquid formulation, Human |
| Artikelnummer: | TRZ-P2020-001_1000 |
| Hersteller Artikelnummer: | P2020-001_1000 |
| Alternativnummer: | TRZ-P2020-001_1000 |
| Hersteller: | trenzyme |
| Wirt: | Human |
| Kategorie: | Biochemikalien |
| Applikation: | ELISA, FA, WB |
| Spezies Reaktivität: | Virus |
| Alternative Synonym: | SARS-CoV-2, coronavirus, SARS-CoV-2 spike RBD, SARS-CoV-2 spike protein, 2019-nCoV, COVID-2019, COVID-19, covid-19, sars-cov-2 |
| The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe acute respiratory syndrome-coronavirus (SARS-CoV) spike (S) glycoprotein is responsible for membrane fusion and is therefore required for virus entry and cell fusion. The target protein is also a major immunogen and a possible target for entry inhibitors. The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). The S2 subunit mediates fusion between the viral and host cell membranes. The S1 RBD protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity. |
| Molekulargewicht: | 27,5 kDa |
| UniProt: | P0DTC2 |
| Puffer: | PBS |
| Reinheit: | > 85% as determined by SDS-PAGE |
| Formulierung: | liquid |
| Sequenz: | MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGF QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
| Formel: | pH 7,4 |
|
|
SDS-PAGE of Spike S1 RBD |
|
|
Structural model of Spike S1 RBD |
|
|
Analysis of released N-glycans by HILIC |
|
|
hACE2 (ECD) to SARS-CoV-2 Spike S1 (RBD) biolayer interferometry |
|
|
Activity of SARS-CoV-2 S1 (RBD) |
|
|
Determination of elution profile by absorbance at 289 nm (blue line) |
|
|
Histogram of Spike S1 RBD |
|
|
Stability during storage at 4C |
Produktgarantie und fachkundiger Support
