RNF113A (RNF113, ZNF183), Mouse

Produktübersicht

• Artikelname: RNF113A (RNF113, ZNF183), Mouse
• Artikelnummer: USB-470140
• Hersteller Artikelnummer: 470140
• Alternativnummer: USB-470140-50
• Hersteller: US Biological
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: IF, WB
• Immunogen: Protein corresponding to aa1-343 from full length human RNF113A

Produktbeschreibung

Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAEQLSPGKAVDQVCTFLFKKPGRKGAAGRRKRPAC DPEPGESGSSSDEGCTVVRPEKKRVTHNP

Produkteigenschaften

• NCBI: 006978
• Reinheit: Purified
• Formulierung: Supplied as a liquid in PBS, pH 7.4.