RP5-821D11.2 (MGC40042), Mouse

Artikelnummer: USB-470144
Artikelname: RP5-821D11.2 (MGC40042), Mouse
Artikelnummer: USB-470144
Hersteller Artikelnummer: 470144
Alternativnummer: USB-470144-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: WB
Immunogen: Protein corresponding to aa1-238 from full length human RP5-821D11.2.
Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLALTLAKADSPRTALLCSAWLLTASFSAQQHKGSLQ VHQTLSVEMDQVLKALSFPKKKAALLSAAILCFLRTALR QSFSSALV
NCBI: 032248
Reinheit: Ascites
Formulierung: Supplied as a liquid. No preservative added.