RXFP1 (LGR7, LGR7.1, LGR7.10, LGR7.2, MGC138347, MGC142177, RXFPR1), Mouse

Artikelnummer: USB-470146
Artikelname: RXFP1 (LGR7, LGR7.1, LGR7.10, LGR7.2, MGC138347, MGC142177, RXFPR1), Mouse
Artikelnummer: USB-470146
Hersteller Artikelnummer: 470146
Alternativnummer: USB-470146-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: WB
Immunogen: Protein corresponding to aa1-757 from full length human RXFP1.
Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTSGSVFFYILIFGKYFSHGGGQDVKCSLGYFPCGNIT KCLPQLLHCNGVDDCGNQADEDNCGDNNGWSLQFD KYFASYYKMTS
NCBI: 258496
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.4.