Anti-Bax Picoband Antibody, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-Bax Picoband Antibody, Rabbit, Polyclonal
• Biozol Catalog Number: ABT-ABO10036
• Supplier Catalog Number: ABO10036
• Alternative Catalog Number: ABT-ABO10036-100UG
• Manufacturer: Abcepta
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids.
• Alternative Names: Apoptosis regulator BAX, Bcl-2-like protein 4, Bcl2-L-4, BAX, BCL2L4

Product Description

Rabbit IgG polyclonal antibody for Apoptosis regulator BAX(BAX) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Product Properties

• Clonality: Polyclonal
• Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molecular Weight: 21184
• NCBI: 581
• UniProt: Q07812
• Form: Lyophilized
• Antibody Type: Polyclonal Antibody

Application Notes

• Application Notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Images