Anti-HDGF Picoband Antibody, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-HDGF Picoband Antibody, Rabbit, Polyclonal
• Biozol Catalog Number: ABT-ABO10143
• Supplier Catalog Number: ABO10143
• Alternative Catalog Number: ABT-ABO10143-100UG
• Manufacturer: Abcepta
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HDGF (61-97aa KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA), identical to the related mouse and rat sequences.
• Alternative Names: Hepatoma-derived growth factor, HDGF, High mobility group protein 1-like 2, HMG-1L2, HDGF, HMG1L2

Product Description

Rabbit IgG polyclonal antibody for Hepatoma-derived growth factor(HDGF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Product Properties

• Clonality: Polyclonal
• Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molecular Weight: 26788
• NCBI: 3068
• UniProt: P51858
• Form: Lyophilized
• Antibody Type: Polyclonal Antibody

Application Notes

• Application Notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Images