Anti-CA12 Antibody 100ul, IgG2a, Clone: [CL0278], Unconjugated, Mouse, Monoclonal
Catalog Number:
ATA-AMAB90637
Article Name: |
Anti-CA12 Antibody 100ul, IgG2a, Clone: [CL0278], Unconjugated, Mouse, Monoclonal |
Biozol Catalog Number: |
ATA-AMAB90637 |
Supplier Catalog Number: |
AMAb90637 |
Alternative Catalog Number: |
ATA-AMAB90637-100,ATA-AMAB90637-25 |
Manufacturer: |
Atlas Antibodies |
Host: |
Mouse |
Category: |
Antikörper |
Application: |
IHC, WB |
Species Reactivity: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Conjugation: |
Unconjugated |
Alternative Names: |
HsT18816 |
Clonality: |
Monoclonal |
Concentration: |
1 |
Clone Designation: |
[CL0278] |
Isotype: |
IgG2a |
NCBI: |
771 |
UniProt: |
O43570 |
Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Purity: |
Protein A purified |
Sequence: |
TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ |
Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target: |
CA12 |
Antibody Type: |
Monoclonal Antibody |
Application Dilute: |
IHC: 1:2500 - 1:5000, WB: 1 µg/ml |
|
Immunohistochemical staining of human kidney shows strong membranous immunoreactivity in renal tubules, but not glomeruli. |
|
Immunohistochemical staining of human rectum shows strong membranous positivity in glandular epithelial cells. |
|
Immunohistochemical staining of human stomach shows moderate membranous immunoreactivity in glandular cells. |
|
Immunohistochemical staining of human renal cancer shows membranous positivity in tumor cells. |
|
Lane 1: Marker [kDa] Lane 2: Human tonsil tissue lysate |
|
AMAb90637 |
|
|
|
AMAb90637 |
|
AMAb90637 |