Recombinant Human NAD-dependent malic enzyme, mitochondrial protein(ME2) (Active)
Catalog Number:
CSB-AP000101HU
- Images (0)
| Article Name: | Recombinant Human NAD-dependent malic enzyme, mitochondrial protein(ME2) (Active) |
| Biozol Catalog Number: | CSB-AP000101HU |
| Supplier Catalog Number: | CSB-AP000101HU |
| Alternative Catalog Number: | CSB-AP000101HU-500, CSB-AP000101HU-100, CSB-AP000101HU-5 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | NAD-ME, Malic enzyme 2 |
| Molecular Weight: | 64.4 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | P23368 |
| Buffer: | Lyophilized from a 0.2 µm filtered PBS, pH 7.4. |
| Source: | E.Coli |
| Expression System: | 19-584aa |
| Purity: | >95% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYRE |
Product Guarantee and Expert Support
