RP5-821D11.2 (MGC40042), Mouse

Product Overview

• Article Name: RP5-821D11.2 (MGC40042), Mouse
• Biozol Catalog Number: USB-470144
• Supplier Catalog Number: 470144
• Alternative Catalog Number: USB-470144-50
• Manufacturer: US Biological
• Host: Mouse
• Category: Antikörper
• Application: WB
• Immunogen: Protein corresponding to aa1-238 from full length human RP5-821D11.2.

Product Description

Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLALTLAKADSPRTALLCSAWLLTASFSAQQHKGSLQ VHQTLSVEMDQVLKALSFPKKKAALLSAAILCFLRTALR QSFSSALV

Product Properties

• NCBI: 032248
• Purity: Ascites
• Form: Supplied as a liquid. No preservative added.