RXFP1 (LGR7, LGR7.1, LGR7.10, LGR7.2, MGC138347, MGC142177, RXFPR1), Mouse

Catalog Number: USB-470146
Article Name: RXFP1 (LGR7, LGR7.1, LGR7.10, LGR7.2, MGC138347, MGC142177, RXFPR1), Mouse
Biozol Catalog Number: USB-470146
Supplier Catalog Number: 470146
Alternative Catalog Number: USB-470146-50
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: WB
Immunogen: Protein corresponding to aa1-757 from full length human RXFP1.
Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTSGSVFFYILIFGKYFSHGGGQDVKCSLGYFPCGNIT KCLPQLLHCNGVDDCGNQADEDNCGDNNGWSLQFD KYFASYYKMTS
NCBI: 258496
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.4.